ZFYVE27 (NM_001002261) Human Recombinant Protein
SKU
TP319897
Recombinant protein of human zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC219897 representing NM_001002261
Red=Cloning site Green=Tags(s) MQTSEREGSGPELSPSVMPEAPLESPPFPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDGVRYLLRWQMP LCSLLTCLGLNVLFLTLNEGAWYSVGALMISVPALLGYLQEVCRARLPDSELMRRKYHSVRQEDLQRGRL SRPEAVAEVKSFLIQLEAFLSRLCCTCEAAYRVLHWENPVVSSQFYGALLGTVCMLYLLPLCWVLTLLNS TLFLGNVEFFRVVSEYRASLQQRMNPKQEEHAFESPPPPDVGGKDGLMDSTPALTPTESLSSQDLTPGSV EEAEEAEPDEEFKDAIEETHLVVLEDDEGAPCPAEDELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTN NFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001002261 |
Locus ID | 118813 |
UniProt ID | Q5T4F4 |
Cytogenetics | 10q24.2 |
RefSeq Size | 3045 |
RefSeq ORF | 1248 |
Synonyms | PROTRUDIN; SPG33 |
Summary | This gene encodes a protein with several transmembrane domains, a Rab11-binding domain and a lipid-binding FYVE finger domain. The encoded protein appears to promote neurite formation. A mutation in this gene has been reported to be associated with hereditary spastic paraplegia, however the pathogenicity of the mutation, which may simply represent a polymorphism, is unclear. [provided by RefSeq, Mar 2010] |
Protein Families | Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH306193 | ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_653189) | 10 ug |
$3,255.00
|
|
PH319897 | ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_001002261) | 10 ug |
$3,255.00
|
|
LC403394 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC424194 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424195 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432830 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432865 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432877 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432956 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403394 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 2 | 100 ug |
$436.00
|
|
LY424194 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 1 | 100 ug |
$665.00
|
|
LY424195 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 3 | 100 ug |
$436.00
|
|
LY432830 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 7 | 100 ug |
$436.00
|
|
LY432865 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 6 | 100 ug |
$436.00
|
|
LY432877 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 5 | 100 ug |
$436.00
|
|
LY432956 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 4 | 100 ug |
$436.00
|
|
TP306193 | Recombinant protein of human zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP329865 | Purified recombinant protein of Homo sapiens zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 6, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP329877 | Purified recombinant protein of Homo sapiens zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 5, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.