ZFYVE27 (NM_001002261) Human Mass Spec Standard

SKU
PH319897
ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_001002261)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219897]
Predicted MW 46.2 kDa
Protein Sequence
Protein Sequence
>RC219897 representing NM_001002261
Red=Cloning site Green=Tags(s)

MQTSEREGSGPELSPSVMPEAPLESPPFPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDGVRYLLRWQMP
LCSLLTCLGLNVLFLTLNEGAWYSVGALMISVPALLGYLQEVCRARLPDSELMRRKYHSVRQEDLQRGRL
SRPEAVAEVKSFLIQLEAFLSRLCCTCEAAYRVLHWENPVVSSQFYGALLGTVCMLYLLPLCWVLTLLNS
TLFLGNVEFFRVVSEYRASLQQRMNPKQEEHAFESPPPPDVGGKDGLMDSTPALTPTESLSSQDLTPGSV
EEAEEAEPDEEFKDAIEETHLVVLEDDEGAPCPAEDELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTN
NFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001002261
RefSeq Size 3045
RefSeq ORF 1248
Synonyms PROTRUDIN; SPG33
Locus ID 118813
UniProt ID Q5T4F4
Cytogenetics 10q24.2
Summary This gene encodes a protein with several transmembrane domains, a Rab11-binding domain and a lipid-binding FYVE finger domain. The encoded protein appears to promote neurite formation. A mutation in this gene has been reported to be associated with hereditary spastic paraplegia, however the pathogenicity of the mutation, which may simply represent a polymorphism, is unclear. [provided by RefSeq, Mar 2010]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ZFYVE27 (NM_001002261) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH306193 ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_653189) 10 ug
$3,255.00
LC403394 ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424194 ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424195 ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432830 ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432865 ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432877 ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432956 ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403394 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 2 100 ug
$436.00
LY424194 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 1 100 ug
$665.00
LY424195 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 3 100 ug
$436.00
LY432830 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 7 100 ug
$436.00
LY432865 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 6 100 ug
$436.00
LY432877 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 5 100 ug
$436.00
LY432956 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 4 100 ug
$436.00
TP306193 Recombinant protein of human zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319897 Recombinant protein of human zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP329865 Purified recombinant protein of Homo sapiens zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 6, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP329877 Purified recombinant protein of Homo sapiens zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.