OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TAL2 (NM_005421) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP324692
Recombinant protein of human T-cell acute lymphocytic leukemia 2 (TAL2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA330033 Rabbit Polyclonal Anti-TAL2 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TAL2 or NM_005421"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224692 protein sequence
Red=Cloning site Green=Tags(s)

MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAA
QGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 12.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005412
Locus ID 6887
UniProt ID Q16559
Cytogenetics 9q31.2
RefSeq Size 656
RefSeq ORF 324
Summary This intronless gene encodes a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia. provided by RefSeq, Mar 2009
Protein Categories Cancer: Haematopoietic and Lymphoid, Growth Factors, Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TAL2" proteins (3)
SKU Description Size Price
PH324692 TAL2 MS Standard C13 and N15-labeled recombinant protein (NP_005412) 10 ug
$3,360.00
LC417315 Lyophilized TAL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417315 Transient overexpression lysate of T-cell acute lymphocytic leukemia 2 (TAL2) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products