TAL2 Rabbit Polyclonal Antibody

SKU TA330033

Rabbit Polyclonal Anti-TAL2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAL2 antibody: synthetic peptide directed towards the middle region of human TAL2. Synthetic peptide located within the following region: LGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 12 kDa
• Gene Name: T-cell acute lymphocytic leukemia 2
• Database Link:
  NP_005412
  Q16559
• Background: TAL2 is a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia.
• Synonyms: bHLHa19; T-cell acute lymphocytic leukemia 2
• Note: Immunogen sequence homology: Human: 100%; Bovine: 78%

Reference Data

• Protein Families: Druggable Genome