TAL2 (NM_005421) Human Recombinant Protein

SKU TP324692

Recombinant protein of human T-cell acute lymphocytic leukemia 2 (TAL2), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC224692 protein sequence; Red=Cloning site Green=Tags(s); ; MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAA; QGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_005412
• Locus ID: 6887
• UniProt ID: Q16559
• Cytogenetics: 9q31.2
• RefSeq Size: 656
• RefSeq ORF: 324
• Summary: This intronless gene encodes a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia. [provided by RefSeq, Mar 2009]
• Protein Families: Druggable Genome