TAL2 (NM_005421) Human Mass Spec Standard

SKU PH324692

TAL2 MS Standard C13 and N15-labeled recombinant protein (NP_005412)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC224692]
• Predicted MW: 12.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC224692 protein sequence; Red=Cloning site Green=Tags(s); ; MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAA; QGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_005412
• RefSeq Size: 656
• RefSeq ORF: 324
• Locus ID: 6887
• UniProt ID: Q16559
• Cytogenetics: 9q31.2
• Summary: This intronless gene encodes a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia. [provided by RefSeq, Mar 2009]
• Protein Families: Druggable Genome