OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WTAP (NM_152857) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP323046
Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA808317 WTAP mouse monoclonal antibody, clone OTI12G7 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "WTAP or NM_152857"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223046 representing NM_152857
Red=Cloning site Green=Tags(s)

MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESA
RRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQN
ELSAWKFTPDR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 17.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_690596
Locus ID 9589
UniProt ID Q15007
Cytogenetics 6q25.3
RefSeq Size 1644
RefSeq ORF 453
Synonyms Mum2
Summary The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in several transcript variants encoding three different isoforms. provided by RefSeq, Jul 2012
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "WTAP" proteins (13)
SKU Description Size Price
PH309632 WTAP MS Standard C13 and N15-labeled recombinant protein (NP_004897) 10 ug
$3,360.00
PH323046 WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690596) 10 ug
$3,360.00
PH323099 WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690597) 10 ug
$3,360.00
LC407186 Lyophilized WTAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407187 Lyophilized WTAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417661 Lyophilized WTAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430230 Lyophilized WTAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407186 Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY407187 Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY417661 Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY430230 Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP309632 Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 1, 20 µg 20 ug
$867.00
TP323099 Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products