OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WTAP (NM_152858) Human Mass Spec Standard

Be the first to review this product
SKU
PH323099
WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690597)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808317 WTAP mouse monoclonal antibody, clone OTI12G7 100 ul
$447.00
LY407186 Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "WTAP or NM_152858"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223099
Predicted MW 17.6 kDa
Protein Sequence
Protein Sequence
>RC223099 representing NM_152858
Red=Cloning site Green=Tags(s)

MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESA
RRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQN
ELSAWKFTPDR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_690597
RefSeq Size 1742
RefSeq ORF 453
Synonyms Mum2
Locus ID 9589
UniProt ID Q15007
Cytogenetics 6q25.3
Summary The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in several transcript variants encoding three different isoforms. provided by RefSeq, Jul 2012
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "WTAP" proteins (13)
SKU Description Size Price
PH309632 WTAP MS Standard C13 and N15-labeled recombinant protein (NP_004897) 10 ug
$3,360.00
PH323046 WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690596) 10 ug
$3,360.00
LC407186 Lyophilized WTAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407187 Lyophilized WTAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417661 Lyophilized WTAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430230 Lyophilized WTAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407186 Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY407187 Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY417661 Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY430230 Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP309632 Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 1, 20 µg 20 ug
$867.00
TP323046 Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 2, 20 µg 20 ug
$867.00
TP323099 Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products