WTAP (NM_152858) Human Recombinant Protein
SKU
TP323099
Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 3, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC223099 representing NM_152858
Red=Cloning site Green=Tags(s) MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESA RRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQN ELSAWKFTPDR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_690597 |
Locus ID | 9589 |
UniProt ID | Q15007 |
Cytogenetics | 6q25.3 |
RefSeq Size | 1742 |
RefSeq ORF | 453 |
Synonyms | Mum2 |
Summary | The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in several transcript variants encoding three different isoforms. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH309632 | WTAP MS Standard C13 and N15-labeled recombinant protein (NP_004897) | 10 ug |
$3,255.00
|
|
PH323046 | WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690596) | 10 ug |
$3,255.00
|
|
PH323099 | WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690597) | 10 ug |
$3,255.00
|
|
LC407186 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC407187 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC417661 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC430230 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY407186 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 2 | 100 ug |
$436.00
|
|
LY407187 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 | 100 ug |
$436.00
|
|
LY417661 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 1 | 100 ug |
$436.00
|
|
LY430230 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 | 100 ug |
$436.00
|
|
TP309632 | Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP323046 | Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.