WTAP (NM_152857) Human Mass Spec Standard

SKU
PH323046
WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690596)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223046]
Predicted MW 17.6 kDa
Protein Sequence
Protein Sequence
>RC223046 representing NM_152857
Red=Cloning site Green=Tags(s)

MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESA
RRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQN
ELSAWKFTPDR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_690596
RefSeq Size 1644
RefSeq ORF 453
Synonyms Mum2
Locus ID 9589
UniProt ID Q15007
Cytogenetics 6q25.3
Summary The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in several transcript variants encoding three different isoforms. [provided by RefSeq, Jul 2012]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:WTAP (NM_152857) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309632 WTAP MS Standard C13 and N15-labeled recombinant protein (NP_004897) 10 ug
$3,255.00
PH323099 WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690597) 10 ug
$3,255.00
LC407186 WTAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407187 WTAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417661 WTAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430230 WTAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407186 Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 2 100 ug
$436.00
LY407187 Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 100 ug
$436.00
LY417661 Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 1 100 ug
$436.00
LY430230 Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 100 ug
$436.00
TP309632 Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323046 Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323099 Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.