DPPA5 (NM_001025290) Human Recombinant Protein

CAT#: TP322509

Recombinant protein of human developmental pluripotency associated 5 (DPPA5), 20 µg

Product Images

Coomassie blue staining of purified DPPA5 protein (Cat# TP322509). The protein was produced from HEK293T cells transfected with DPPA5 cDNA clone (Cat# RC222509) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222509 representing NM_001025290
  Red=Cloning site Green=Tags(s)
  
  MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVV
  YGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001020461
• Locus ID: 340168
• UniProt ID: A6NC42
• Cytogenetics: 6q13
• Refseq Size: 612
• Refseq ORF: 348
• Synonyms: ESG1
• Summary: This gene encodes a protein that may function in the control of cell pluripotency and early embryogenesis. Expression of this gene is a specific marker for pluripotent stem cells. Pseudogenes of this gene are located on the short arm of chromosome 10 and the long arm of chromosomes 14 and 19. [provided by RefSeq, Dec 2010]