DPPA5 (NM_001025290) Human Recombinant Protein

SKU
TP322509M
Recombinant protein of human developmental pluripotency associated 5 (DPPA5), 100 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$2,950.00
6 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222509 representing NM_001025290
Red=Cloning site Green=Tags(s)

MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVV
YGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 13.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001020461
Locus ID 340168
UniProt ID A6NC42
Cytogenetics 6q13
RefSeq Size 612
RefSeq ORF 348
Synonyms ESG1
Summary This gene encodes a protein that may function in the control of cell pluripotency and early embryogenesis. Expression of this gene is a specific marker for pluripotent stem cells. Pseudogenes of this gene are located on the short arm of chromosome 10 and the long arm of chromosomes 14 and 19. [provided by RefSeq, Dec 2010]
Write Your Own Review
You're reviewing:DPPA5 (NM_001025290) Human Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.