OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DPPA5 (NM_001025290) Human Mass Spec Standard

Be the first to review this product
SKU
PH322509
DPPA5 MS Standard C13 and N15-labeled recombinant protein (NP_001020461)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA810842 DPPA5 mouse monoclonal antibody,clone OTI2F6 100 ul
$447.00
LY400405 Transient overexpression lysate of developmental pluripotency associated 5 (DPPA5) (as WB positive control) 100 ug
$436.00

Other products for "DPPA5 or NM_001025290"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222509
Predicted MW 13.3 kDa
Protein Sequence
Protein Sequence
>RC222509 representing NM_001025290
Red=Cloning site Green=Tags(s)

MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVV
YGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020461
RefSeq Size 612
RefSeq ORF 348
Synonyms ESG1
Locus ID 340168
UniProt ID A6NC42
Cytogenetics 6q13
Summary This gene encodes a protein that may function in the control of cell pluripotency and early embryogenesis. Expression of this gene is a specific marker for pluripotent stem cells. Pseudogenes of this gene are located on the short arm of chromosome 10 and the long arm of chromosomes 14 and 19. provided by RefSeq, Dec 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DPPA5" proteins (3)
SKU Description Size Price
LC400405 Lyophilized DPPA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400405 Transient overexpression lysate of developmental pluripotency associated 5 (DPPA5) (as WB positive control) 100 ug
$436.00
TP322509 Recombinant protein of human developmental pluripotency associated 5 (DPPA5), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products