HTRA1 (NM_002775) Human Recombinant Protein

CAT#: TP322362

Recombinant protein of human HtrA serine peptidase 1 (HTRA1), 20 µg

Product Images

An in vitro cleavage assay shows TSP1 is a direct substrate of HtrA1. TSP1 (500 ng) were incubated with the indicated amount of active HtrA1WT (WT) (OriGene TP322362) or inactive HtrA1S328A (S328A) (OriGene TP700208). The cleavage events were analyzed by immunoblotting. The filled triangle is the full-length form of TSP1 and HtrA1. The empty triangle is proteolysis products. TSP1 was probed using an antibody specific to the N-terminal domain. The molecular weight (kDa) reference is indicated in the left side of the image. Figure cited from Matrix Biol, PMID: 29572155

• 

  HtrA1 degrades preformed microtubules and avoids polymerization in vitro. Fluorescently labeled microtubules were polymerized in vitro and incubated with S328A HtrA1 (OriGene, TP700208) (center) and HtrA1 (OriGene, TP322362) (right). Images were acquired at 5 minutes, 6 hours, and 24 hours after adding HtrA1. Scale bar, 10 um. Figure cited from EBioMedicine, PMID: 29269042

• 

  Coomassie blue staining of purified HTRA1 protein (Cat# TP322362). The protein was produced from HEK293T cells transfected with HTRA1 cDNA clone (Cat# RC222362) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC222362
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCG
  APEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRR
  SERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGF
  IVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPG
  EFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTL
  KVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYI
  IEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP
  
  
  Recombinant protein using RC222362 also available, TP322362
• Tag: C-Myc/DDK
• Predicted MW: 49 kDa
• Concentration: >0.1 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Protein degradation enzyme (PMID: 29269042)
  Enzyme activity (PMID: 29572155)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002766
• Locus ID: 5654
• UniProt ID: Q92743
• Cytogenetics: 10q26.13
• Refseq Size: 2133
• Refseq ORF: 1440
• Synonyms: ARMD7; CADASIL2; CARASIL; HtrA; L56; ORF480; PRSS11
• Summary: This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protease, Secreted Protein