HTRA1 (NM_002775) Human Mass Spec Standard

SKU
PH322362
HTRA1 MS Standard C13 and N15-labeled recombinant protein (NP_002766)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222362]
Predicted MW 51.3 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC222362
Blue=ORF Red=Cloning site Green=Tag(s)

MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCG
APEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRR
SERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGF
IVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPG
EFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTL
KVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYI
IEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP



Recombinant protein using RC222362 also available, TP322362
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002766
RefSeq Size 2133
RefSeq ORF 2622
Synonyms ARMD7; CADASIL2; CARASIL; HtrA; L56; ORF480; PRSS11
Locus ID 5654
UniProt ID Q92743
Cytogenetics 10q26.13
Summary This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protease, Secreted Protein
Write Your Own Review
You're reviewing:HTRA1 (NM_002775) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400983 HTRA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400983 Transient overexpression lysate of HtrA serine peptidase 1 (HTRA1) 100 ug
$665.00
TP322362 Recombinant protein of human HtrA serine peptidase 1 (HTRA1), 20 µg 20 ug
$867.00
TP700208 Recombinant protein of human HtrA serine peptidase 1 (HTRA1), S328A mutant, 20 ug 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.