OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HTRA1 (NM_002775) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC222362
HTRA1 (Myc-DDK-tagged)-Human HtrA serine peptidase 1 (HTRA1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
5 Days*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
TA816106 HTRA1 mouse monoclonal antibody,clone OTI2F12 100 ul
$447.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "HTRA1 or NM_002775"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HTRA1
Synonyms ARMD7; CADASIL2; CARASIL; HtrA; L56; ORF480; PRSS11
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222362 representing NM_002775
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGATCCCGCGCGCCGCTCTTCTCCCGCTGCTGCTGCTGCTGCTGGCGGCGCCCGCCTCGGCGCAGC
TGTCCCGGGCCGGCCGCTCGGCGCCTTTGGCTGCCGGTTGCCCAGACCGCTGCGAGCCGGCGCGCTGCCC
GCCGCAGCCGGAGCACTGCGAGGGCGGCCGGGCCCGGGACGCGTGCGGCTGCTGCGAGGTGTGCGGCGCG
CCCGAGGGCGCCGCGTGCGGCCTGCAGGAGGGCCCGTGCGGCGAGGGGCTGCAGTGCGTGGTGCCCTTCG
GGGTGCCAGCCTCGGCCACGGTGCGGCGGCGCGCGCAGGCCGGCCTCTGTGTGTGCGCCAGCAGCGAGCC
GGTGTGCGGCAGCGACGCCAACACCTACGCCAACCTGTGCCAGCTGCGCGCCGCCAGCCGCCGCTCCGAG
AGGCTGCACCGGCCGCCGGTCATCGTCCTGCAGCGCGGAGCCTGCGGCCAAGGGCAGGAAGATCCCAACA
GTTTGCGCCATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATCGA
ATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCG
GAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAGA
ACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGA
CCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGAGAGTTCGTGGTC
GCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCG
GCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATCAACTATGGAAA
CTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGA
ATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAG
GAAAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAAGA
GCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGAT
ACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTCT
CCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGA
AGATATCATGATCACAGTGATTCCCGAAGAAATTGACCCA

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>Peptide sequence encoded by RC222362
Blue=ORF Red=Cloning site Green=Tag(s)

MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCG
APEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRR
SERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGF
IVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPG
EFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTL
KVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYI
IEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP


Recombinant protein using RC222362 also available, TP322362
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene | Plasmid Map
ACCN NM_002775
ORF Size 1440 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002775.3, NP_002766.1
RefSeq Size 2133 bp
RefSeq ORF 1443 bp
Locus ID 5654
UniProt ID Q92743
Cytogenetics 10q26.13
Domains IB, kazal, PDZ, Tryp_SPc
Protein Families Druggable Genome, Protease, Secreted Protein
MW 51.3 kDa
Summary This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_002775" in other vectors (6)
SKU Description Size Price
RC222362L1 Lenti ORF clone of Human HtrA serine peptidase 1 (HTRA1), Myc-DDK-tagged 10 ug
$757.00
RC222362L2 Lenti ORF clone of Human HtrA serine peptidase 1 (HTRA1), mGFP tagged 10 ug
$757.00
RC222362L3 Lenti ORF clone of Human HtrA serine peptidase 1 (HTRA1), Myc-DDK-tagged 10 ug
$757.00
RC222362L4 Lenti ORF clone of Human HtrA serine peptidase 1 (HTRA1), mGFP tagged 10 ug
$757.00
RG222362 HTRA1 (tGFP-tagged) - Human HtrA serine peptidase 1 (HTRA1) 10 ug
$489.00 $657.00
SC118403 HTRA1 (untagged)-Human HtrA serine peptidase 1 (HTRA1) 10 ug
$457.00

Plasmid Map for RC222362

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC222362
Circular map for RC222362

file-alt Citations

Htra1 is a Novel Transcriptional Target of RUNX2 That Promotes Osteogenic Differentiation
Iyyanar, Thangaraj, Eames et al
Cell. Physiol. Biochem. (2019) 53 (5), 832-850 DOI: 10.33594/000000176
AI Summary: OriGene's Htra1 overexpression vector (OriGene) was used to transfect primary mouse mesenchymal progenitor cells, enabling the study of Htra1's role in osteogenic differentiation as a direct transcriptional target of RUNX2.
Snippet: Htra1 overexpression transfections Htra1 vector (Origene) was digested using SalI and XhoI restriction enzymes to separate the Htra1 cDNA, and the empty vector (pCMV6-myc- ddk) was generated by self-ligation of SalI and XhoI compatible sticky ends View as HTML
The differential role of HTRA1 in HPV-positive and HPV-negative cervical cell line proliferation
Stuqui, Conceição, Termini et al
BMC Cancer (2016) 16 (1), 840 DOI: 10.1186/s12885-016-2873-1
Cited by 14
AI Summary: OriGene products pCMV6/Entry and pCMV6/HTRA1 plasmids were used in this study to overexpress HTRA1 in cervical cell lines, enabling the investigation of HTRA1’s role in cell proliferation in HPV-positive and HPV-negative contexts.
Snippet: 37 C, 5 % CO 2 atmosphere. Plasmids and transfection. pCMV6/Entry andpCMV6/HTRA1 were obtained from Origene Technologies (Origene Technologies, Rockville,MD, USA). pCMV6 vectors contain the neomycin phosphotransferase ... Cite SaveSaving
FigureFigureFigure
HtrA1 Proteolysis of ApoE In Vitro Is Allele Selective
Chu, Diedrich, Vaughan et al
J. Am. Chem. Soc. (2016) 138 (30), 9473-8 DOI: 10.1021/jacs.6b03463
Cited by 46
AI Summary: OriGene contributed mammalian expression constructs of HtrA1 cDNA clones with a C-terminal myc tag, which were used to study the allele-selective degradation of ApoE proteins in this research.
Snippet: ApoE3 and ApoE4 coding sequences were then subcloned into pMAL vector (New England Biolabs) with a TEV cleavage site between ApoE protein and MBP fusion for bacterial expression. Mammalian expression constructs of HtrA1 cDNA clones with a C-terminal myc tag were obtained from Origene
Caracterização funcional de HTRA1 em linhagens celulares HPV positiva e HPV negativa
Stuqui
(2014)
Snippet: Page 25. 23 3. MATERIAL E MÉTODOS 3.1. Clonagem e Sequenciamento Os vetores de expressão pCMV6/Entry (vetor vazio) e pCMV6/HTRA1 (OriGene Technologies, cat. PS100001 e RC222362), contendo gene de resistência a Canamicina, foram ... Cite SaveSaving
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products