HTRA1 (NM_002775) Human Recombinant Protein

SKU
TP322362
Recombinant protein of human HtrA serine peptidase 1 (HTRA1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>Peptide sequence encoded by RC222362
Blue=ORF Red=Cloning site Green=Tag(s)

MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCG
APEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRR
SERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGF
IVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPG
EFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTL
KVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYI
IEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP



Recombinant protein using RC222362 also available, TP322362
Tag C-Myc/DDK
Predicted MW 49 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Protein degradation enzyme (PMID: 29269042)
Enzyme activity (PMID: 29572155)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002766
Locus ID 5654
UniProt ID Q92743
Cytogenetics 10q26.13
RefSeq Size 2133
RefSeq ORF 1440
Synonyms ARMD7; CADASIL2; CARASIL; HtrA; L56; ORF480; PRSS11
Summary This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protease, Secreted Protein
Write Your Own Review
You're reviewing:HTRA1 (NM_002775) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH322362 HTRA1 MS Standard C13 and N15-labeled recombinant protein (NP_002766) 10 ug
$3,255.00
LC400983 HTRA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400983 Transient overexpression lysate of HtrA serine peptidase 1 (HTRA1) 100 ug
$665.00
TP700208 Recombinant protein of human HtrA serine peptidase 1 (HTRA1), S328A mutant, 20 ug 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.