TNFAIP8 (NM_001077654) Human Recombinant Protein

SKU TP320669

Purified recombinant protein of Homo sapiens tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220669 representing NM_001077654; Red=Cloning site Green=Tags(s); ; MATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVI; KLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAK; SHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001071122
• Locus ID: 25816
• UniProt ID: O95379
• Cytogenetics: 5q23.1
• RefSeq Size: 1979
• RefSeq ORF: 564
• Synonyms: GG2-1; MDC-3.13; NDED; SCC-S2; SCCS2
• Summary: Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome