TNFAIP8 (NM_001077654) Human Mass Spec Standard

SKU
PH320669
TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_001071122)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220669]
Predicted MW 21.7 kDa
Protein Sequence
Protein Sequence
>RC220669 representing NM_001077654
Red=Cloning site Green=Tags(s)

MATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVI
KLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAK
SHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001071122
RefSeq Size 1979
RefSeq ORF 564
Synonyms GG2-1; MDC-3.13; NDED; SCC-S2; SCCS2
Locus ID 25816
UniProt ID O95379
Cytogenetics 5q23.1
Summary Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:TNFAIP8 (NM_001077654) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302729 TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_055165) 10 ug
$3,255.00
LC402318 TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421470 TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425876 TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402318 Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1 100 ug
$436.00
LY421470 Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2 100 ug
$436.00
TP302729 Recombinant protein of human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320669 Purified recombinant protein of Homo sapiens tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.