OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TNFAIP8 (NM_001077654) Human Mass Spec Standard

Be the first to review this product
SKU
PH320669
TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_001071122)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA810682 TNFAIP8 mouse monoclonal antibody,clone OTI1H9 100 ul
$447.00
LY421470 Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "TNFAIP8 or NM_001077654"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220669
Predicted MW 21.7 kDa
Protein Sequence
Protein Sequence
>RC220669 representing NM_001077654
Red=Cloning site Green=Tags(s)

MATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVI
KLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAK
SHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001071122
RefSeq Size 1979
RefSeq ORF 564
Synonyms GG2-1; MDC-3.13; NDED; SCC-S2; SCCS2
Locus ID 25816
UniProt ID O95379
Cytogenetics 5q23.1
Summary Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TNFAIP8" proteins (7)
SKU Description Size Price
PH302729 TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_055165) 10 ug
$3,360.00
LC402318 Lyophilized TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421470 Lyophilized TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402318 Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421470 Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302729 Recombinant protein of human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1, 20 µg 20 ug
$867.00
TP320669 Purified recombinant protein of Homo sapiens tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products