OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TNFAIP8 (NM_001077654) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC220669
TNFAIP8 (Myc-DDK-tagged)-Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA810682 TNFAIP8 mouse monoclonal antibody,clone OTI1H9 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TNFAIP8 or NM_001077654"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TNFAIP8
Synonyms GG2-1; MDC-3.13; NDED; SCC-S2; SCCS2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220669 representing NM_001077654
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACAGATGTCTTTAATTCCAAAAACCTGGCCGTTCAGGCACAAAAGAAGATCTTGGGTAAAATGG
TGTCCAAATCCATCGCCACCACCTTAATAGACGACACAAGTAGTGAGGTGCTGGATGAGCTCTACAGAGT
GACCAGGGAGTACACCCAAAACAAGAAGGAGGCAGAGAAGATCATCAAGAACCTCATCAAGACAGTCATC
AAGCTGGCCATTCTTTATAGGAATAATCAGTTTAATCAAGATGAGCTAGCATTGATGGAGAAATTTAAGA
AGAAAGTTCATCAGCTTGCTATGACCGTGGTCAGTTTCCATCAGGTGGATTATACCTTTGACCGGAATGT
GTTATCCAGGCTGTTAAATGAATGCAGAGAGATGCTGCACCAAATCATTCAGCGCCACCTCACTGCCAAG
TCACATGGACGGGTTAATAATGTGTTTGATCATTTTTCAGATTGTGAATTTTTGGCTGCCTTGTATAATC
CTTTTGGGAATTTTAAACCCCACTTACAAAAACTATGTGATGGTATCAACAAAATGTTGGATGAAGAGAA
CATA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC220669 representing NM_001077654
Red=Cloning site Green=Tags(s)

MATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVI
KLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAK
SHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001077654
ORF Size 564 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001077654.3
RefSeq Size 1979 bp
RefSeq ORF 567 bp
Locus ID 25816
UniProt ID O95379
Cytogenetics 5q23.1
Protein Families Druggable Genome
MW 21.7 kDa
Summary Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001077654" in other vectors (6)
SKU Description Size Price
RC220669L1 Lenti ORF clone of Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC220669L2 Lenti ORF clone of Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2, mGFP tagged 10 ug
$600.00
RC220669L3 Lenti ORF clone of Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC220669L4 Lenti ORF clone of Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2, mGFP tagged 10 ug
$600.00
RG220669 TNFAIP8 (tGFP-tagged) - Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2 10 ug
$489.00 $500.00
SC315484 TNFAIP8 (untagged)-Human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2 10 ug
$330.00

Plasmid Map for RC220669

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC220669
Circular map for RC220669

file-alt Citations

The novel p53 target TNFAIP8 variant 2 is increased in cancer and offsets p53-dependent tumor suppression
Lowe, Nguyen, Grimm et al
Cell Death Differ. (2016)
AI Summary: OriGene’s pCMV-entry empty vector and TNFAIP8 variant 2 expression vector (RC220669) were used for transient overexpression experiments to study the functional role of TNFAIP8 v2 in cancer cells.
Snippet: For v2 overexpression, empty (pCMV-entry, Origene, Rockville, MD, USA) or v2expression vector (RC220669, Origene) were transiently transfected using Lipofectamine 3000(ThermoFisher Scientific, Waltham, MA, USA;24 h). TCGA data analysis. ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products