TNFAIP8 (NM_014350) Human Recombinant Protein
SKU
TP302729
Recombinant protein of human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC202729 protein sequence
Red=Cloning site Green=Tags(s) MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEK IIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLH QIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_055165 |
Locus ID | 25816 |
UniProt ID | O95379 |
Cytogenetics | 5q23.1 |
RefSeq Size | 2103 |
RefSeq ORF | 594 |
Synonyms | GG2-1; MDC-3.13; NDED; SCC-S2; SCCS2 |
Summary | Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH302729 | TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_055165) | 10 ug |
$3,255.00
|
|
PH320669 | TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_001071122) | 10 ug |
$3,255.00
|
|
LC402318 | TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421470 | TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC425876 | TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402318 | Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1 | 100 ug |
$436.00
|
|
LY421470 | Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2 | 100 ug |
$436.00
|
|
TP320669 | Purified recombinant protein of Homo sapiens tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.