TNFAIP8 (NM_014350) Human Recombinant Protein

SKU
TP302729
Recombinant protein of human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202729 protein sequence
Red=Cloning site Green=Tags(s)

MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEK
IIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLH
QIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055165
Locus ID 25816
UniProt ID O95379
Cytogenetics 5q23.1
RefSeq Size 2103
RefSeq ORF 594
Synonyms GG2-1; MDC-3.13; NDED; SCC-S2; SCCS2
Summary Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:TNFAIP8 (NM_014350) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302729 TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_055165) 10 ug
$3,255.00
PH320669 TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_001071122) 10 ug
$3,255.00
LC402318 TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421470 TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425876 TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402318 Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1 100 ug
$436.00
LY421470 Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2 100 ug
$436.00
TP320669 Purified recombinant protein of Homo sapiens tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.