MAZ (NM_002383) Human Recombinant Protein
SKU
TP319635
Recombinant protein of human MYC-associated zinc finger protein (purine-binding transcription factor) (MAZ), transcript variant 1, 20 µg
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC219635 representing NM_002383
Red=Cloning site Green=Tags(s) MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQSPFQAAPAPP PTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVAAAPPAPAAASTVDTAALKQPPAPPPPPPPV SAPAAEAAPPASAATIAAAAATAVVAPTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA IHTGAKAGRVPSGAMKMPTMVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHA CEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPD HLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHV CELCNKGTGEVCPMAAAAAAAAAAAAAAVAAPPTAVGSLSGAEGVPVSSQPLPSQPW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002374 |
Locus ID | 4150 |
UniProt ID | P56270 |
Cytogenetics | 16p11.2 |
RefSeq Size | 1738 |
RefSeq ORF | 1431 |
Synonyms | Pur-1; PUR1; SAF-1; SAF-2; SAF-3; ZF87; Zif87; ZNF801 |
Summary | May function as a transcription factor with dual roles in transcription initiation and termination. Binds to two sites, ME1a1 and ME1a2, within the MYC promoter having greater affinity for the former. Also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors. Regulates inflammation-induced expression of serum amyloid A proteins.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH319635 | MAZ MS Standard C13 and N15-labeled recombinant protein (NP_002374) | 10 ug |
$3,255.00
|
|
LC419359 | MAZ HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC420971 | MAZ HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY419359 | Transient overexpression lysate of MYC-associated zinc finger protein (purine-binding transcription factor) (MAZ), transcript variant 1 | 100 ug |
$665.00
|
|
LY420971 | Transient overexpression lysate of MYC-associated zinc finger protein (purine-binding transcription factor) (MAZ), transcript variant 2 | 100 ug |
$665.00
|
|
Citations |
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.