OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAZ Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA335836
Rabbit Polyclonal Anti-MAZ Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY420971 Transient overexpression lysate of MYC-associated zinc finger protein (purine-binding transcription factor) (MAZ), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP319635 Recombinant protein of human MYC-associated zinc finger protein (purine-binding transcription factor) (MAZ), transcript variant 1, 20 µg
20 ug
$737.00

View other "MAZ or NM_002383" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human, Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-MAZ Antibody: synthetic peptide directed towards the N terminal of human MAZ. Synthetic peptide located within the following region: FPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 48 kDa
Gene Name MYC associated zinc finger protein
Database Link
Background MAZ may function as a transcription factor with dual roles in transcription initiation and termination.It binds to two sites, ME1a1 and ME1a2, within the c-myc promoter having greater affinity for the former. It also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors.
Synonyms Pur-1; PUR1; SAF-1; SAF-2; SAF-3; ZF87; Zif87; ZNF801
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products