MAZ Rabbit Polyclonal Antibody

SKU TA335836

Rabbit Polyclonal Anti-MAZ Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MAZ Antibody: synthetic peptide directed towards the N terminal of human MAZ. Synthetic peptide located within the following region: FPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 48 kDa
• Gene Name: MYC associated zinc finger protein
• Database Link:
  NP_002374
  P56270
• Background: MAZ may function as a transcription factor with dual roles in transcription initiation and termination.It binds to two sites, ME1a1 and ME1a2, within the c-myc promoter having greater affinity for the former. It also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors.
• Synonyms: Pur-1; PUR1; SAF-1; SAF-2; SAF-3; ZF87; Zif87; ZNF801
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%

Reference Data

• Protein Families: Transcription Factors