MAZ (NM_002383) Human Mass Spec Standard

SKU
PH319635
MAZ MS Standard C13 and N15-labeled recombinant protein (NP_002374)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219635]
Predicted MW 48.4 kDa
Protein Sequence
Protein Sequence
>RC219635 representing NM_002383
Red=Cloning site Green=Tags(s)

MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQSPFQAAPAPP
PTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVAAAPPAPAAASTVDTAALKQPPAPPPPPPPV
SAPAAEAAPPASAATIAAAAATAVVAPTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA
IHTGAKAGRVPSGAMKMPTMVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHA
CEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPD
HLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHV
CELCNKGTGEVCPMAAAAAAAAAAAAAAVAAPPTAVGSLSGAEGVPVSSQPLPSQPW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002374
RefSeq Size 1738
RefSeq ORF 1431
Synonyms Pur-1; PUR1; SAF-1; SAF-2; SAF-3; ZF87; Zif87; ZNF801
Locus ID 4150
UniProt ID P56270
Cytogenetics 16p11.2
Summary May function as a transcription factor with dual roles in transcription initiation and termination. Binds to two sites, ME1a1 and ME1a2, within the MYC promoter having greater affinity for the former. Also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors. Regulates inflammation-induced expression of serum amyloid A proteins.[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:MAZ (NM_002383) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419359 MAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420971 MAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419359 Transient overexpression lysate of MYC-associated zinc finger protein (purine-binding transcription factor) (MAZ), transcript variant 1 100 ug
$665.00
LY420971 Transient overexpression lysate of MYC-associated zinc finger protein (purine-binding transcription factor) (MAZ), transcript variant 2 100 ug
$665.00
TP319635 Recombinant protein of human MYC-associated zinc finger protein (purine-binding transcription factor) (MAZ), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.