OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TCF4 (NM_003199) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP317718
Recombinant protein of human transcription factor 4 (TCF4), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA330065 Rabbit Polyclonal Anti-TCF4 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TCF4 or NM_003199"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217718 representing NM_003199
Red=Cloning site Green=Tags(s)

MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRN
YGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLS
PTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATST
FPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPM
STFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVG
SPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG
IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPP
QDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITSNNDDEDLTPEQKAE
REKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKA
ACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 71.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003190
Locus ID 6925
UniProt ID P15884
Cytogenetics 18q21.2
RefSeq Size 2500
RefSeq ORF 2001
Synonyms bHLHb19; CDG2T; E2-2; FECD3; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Summary This gene encodes transcription factor 4, a basic helix-loop-helix transcription factor. The encoded protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. This gene is broadly expressed, and may play an important role in nervous system development. Defects in this gene are a cause of Pitt-Hopkins syndrome. In addition, an intronic CTG repeat normally numbering 10-37 repeat units can expand to >50 repeat units and cause Fuchs endothelial corneal dystrophy. Multiple alternatively spliced transcript variants that encode different proteins have been described. provided by RefSeq, Jul 2016
Protein Categories Intracellular Proteins, Nervous system Diseases, Secreated Proteins, Transciption Factors
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TCF4" proteins (8)
SKU Description Size Price
PH317718 TCF4 MS Standard C13 and N15-labeled recombinant protein (NP_003190) 10 ug
$3,360.00
PH324345 TCF4 MS Standard C13 and N15-labeled recombinant protein (NP_001077431) 10 ug
$3,360.00
LC401106 Lyophilized TCF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421261 Lyophilized TCF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401106 Transient overexpression lysate of transcription factor 4 (TCF4), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY421261 Transient overexpression lysate of transcription factor 4 (TCF4), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP324345 Recombinant protein of human transcription factor 4 (TCF4), transcript variant 1, 20 µg 20 ug
$737.00
TP760702 Purified recombinant protein of Human transcription factor 4 (TCF4), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

Henryin, an ent-kaurane diterpenoid, inhibits Wnt signaling through interference with β-catenin/TCF4 interaction in colorectal cancer cells
Li, Pu, Jiang et al
PLoS ONE (2013) 8 (7), e68525 DOI: 10.1371/journal.pone.0068525
Cited by 46
AI Summary: In this study, OriGene's purified human recombinant TCF4 protein was used to investigate how henryin disrupts the interaction between β-catenin and TCF4 in colorectal cancer cells, thereby elucidating its inhibitory effect on Wnt signaling.
Snippet: Louis, MO, USA). Purified human recombinant proteins β-catenin was purchased from Sino biological inc. Purified human recombinant proteins TCF4 was purchased from OriGene. Dual-luciferase reporter gene assay system was purchased from Promega (Madison, WI, USA).
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products