TCF4 (NM_001083962) Human Mass Spec Standard

SKU
PH324345
TCF4 MS Standard C13 and N15-labeled recombinant protein (NP_001077431)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224345]
Predicted MW 71.6 kDa
Protein Sequence
Protein Sequence
>RC224345 representing NM_001083962
Red=Cloning site Green=Tags(s)

MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRN
YGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLS
PTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATST
FPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPM
STFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVG
SPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG
IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPP
QDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPE
QKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNL
NPKAACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001077431
RefSeq Size 8332
RefSeq ORF 2013
Synonyms bHLHb19; CDG2T; E2-2; FECD3; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
Locus ID 6925
UniProt ID P15884
Cytogenetics 18q21.2
Summary This gene encodes transcription factor 4, a basic helix-loop-helix transcription factor. The encoded protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. This gene is broadly expressed, and may play an important role in nervous system development. Defects in this gene are a cause of Pitt-Hopkins syndrome. In addition, an intronic CTG repeat normally numbering 10-37 repeat units can expand to >50 repeat units and cause Fuchs endothelial corneal dystrophy. Multiple alternatively spliced transcript variants that encode different proteins have been described. [provided by RefSeq, Jul 2016]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Write Your Own Review
You're reviewing:TCF4 (NM_001083962) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317718 TCF4 MS Standard C13 and N15-labeled recombinant protein (NP_003190) 10 ug
$3,255.00
LC401106 TCF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421261 TCF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401106 Transient overexpression lysate of transcription factor 4 (TCF4), transcript variant 2 100 ug
$665.00
LY421261 Transient overexpression lysate of transcription factor 4 (TCF4), transcript variant 1 100 ug
$665.00
TP317718 Recombinant protein of human transcription factor 4 (TCF4), transcript variant 2, 20 µg 20 ug
$737.00
TP324345 Recombinant protein of human transcription factor 4 (TCF4), transcript variant 1, 20 µg 20 ug
$737.00
TP760702 Purified recombinant protein of Human transcription factor 4 (TCF4), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.