OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARMC8 (NM_213654) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315221
Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA365817 ARMC8 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ARMC8 or NM_213654"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215221 protein sequence
Red=Cloning site Green=Tags(s)

MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECA
VVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLM
ALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSM
TLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLL
EERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKL
YASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 42.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_998819
Locus ID 25852
UniProt ID Q8IUR7
Cytogenetics 3q22.3
RefSeq Size 3290
RefSeq ORF 1155
Synonyms GID5; HSPC056; S863-2; VID28
Summary Component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARMC8" proteins (11)
SKU Description Size Price
PH302341 ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_054873) 10 ug
$3,360.00
PH307532 ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_056211) 10 ug
$3,360.00
PH315221 ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_998819) 10 ug
$3,360.00
LC402281 Lyophilized ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403732 Lyophilized ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414566 Lyophilized ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402281 Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY403732 Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY414566 Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302341 Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 1, 20 µg 20 ug
$867.00
TP307532 Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products