OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARMC8 (NM_213654) Human Mass Spec Standard

Be the first to review this product
SKU
PH315221
ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_998819)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365817 ARMC8 rabbit polyclonal antibody
100 ul
$310.00
LY402281 Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ARMC8 or NM_213654"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215221
Predicted MW 43 kDa
Protein Sequence
Protein Sequence
>RC215221 protein sequence
Red=Cloning site Green=Tags(s)

MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECA
VVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLM
ALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSM
TLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLL
EERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKL
YASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_998819
RefSeq Size 3290
RefSeq ORF 1155
Synonyms GID5; HSPC056; S863-2; VID28
Locus ID 25852
UniProt ID Q8IUR7
Cytogenetics 3q22.3
Summary Component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARMC8" proteins (11)
SKU Description Size Price
PH302341 ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_054873) 10 ug
$3,360.00
PH307532 ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_056211) 10 ug
$3,360.00
LC402281 Lyophilized ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403732 Lyophilized ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414566 Lyophilized ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402281 Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY403732 Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY414566 Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302341 Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 1, 20 µg 20 ug
$867.00
TP307532 Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 2, 20 µg 20 ug
$867.00
TP315221 Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products