ARMC8 (NM_014154) Human Mass Spec Standard

SKU
PH302341
ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_054873)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202341]
Predicted MW 43 kDa
Protein Sequence
Protein Sequence
>RC202341 protein sequence
Red=Cloning site Green=Tags(s)

MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECA
VVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLM
ALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSM
TLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLL
EERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKL
YASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054873
RefSeq Size 3236
RefSeq ORF 1155
Synonyms GID5; HSPC056; S863-2; VID28
Locus ID 25852
UniProt ID Q8IUR7
Cytogenetics 3q22.3
Summary Component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ARMC8 (NM_014154) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH307532 ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_056211) 10 ug
$3,255.00
PH315221 ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_998819) 10 ug
$3,255.00
LC402281 ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403732 ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414566 ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402281 Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 1 100 ug
$436.00
LY403732 Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 3 100 ug
$436.00
LY414566 Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 2 100 ug
$436.00
TP302341 Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP307532 Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315221 Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.