ARMC8 (NM_014154) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202341] |
Predicted MW | 43 kDa |
Protein Sequence |
Protein Sequence
>RC202341 protein sequence
Red=Cloning site Green=Tags(s) MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECA VVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLM ALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSM TLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLL EERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKL YASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_054873 |
RefSeq Size | 3236 |
RefSeq ORF | 1155 |
Synonyms | GID5; HSPC056; S863-2; VID28 |
Locus ID | 25852 |
UniProt ID | Q8IUR7 |
Cytogenetics | 3q22.3 |
Summary | Component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH307532 | ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_056211) | 10 ug |
$3,255.00
|
|
PH315221 | ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_998819) | 10 ug |
$3,255.00
|
|
LC402281 | ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC403732 | ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC414566 | ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402281 | Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 1 | 100 ug |
$436.00
|
|
LY403732 | Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 3 | 100 ug |
$436.00
|
|
LY414566 | Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 2 | 100 ug |
$436.00
|
|
TP302341 | Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP307532 | Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP315221 | Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.