RBP1 (NM_002899) Human Recombinant Protein

CAT#: TP314515

Recombinant protein of human retinol binding protein 1, cellular (RBP1), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified RBP1 protein (Cat# TP314515). The protein was produced from HEK293T cells transfected with RBP1 cDNA clone (Cat# RC214515) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC214515 representing NM_002899
  Red=Cloning site Green=Tags(s)
  
  MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKE
  FEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Enzyme activity regulator (PMID: 25502770)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002890
• Locus ID: 5947
• UniProt ID: P09455, A0A0A0MQT0
• Cytogenetics: 3q23
• Refseq Size: 720
• Refseq ORF: 405
• Synonyms: CRABP-I; CRBP; CRBP1; CRBPI; RBPC
• Summary: This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]