RBP1 (NM_002899) Human Mass Spec Standard

SKU
PH314515
RBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002890)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214515]
Predicted MW 15.7 kDa
Protein Sequence
Protein Sequence
>RC214515 representing NM_002899
Red=Cloning site Green=Tags(s)

MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKE
FEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002890
RefSeq Size 720
RefSeq ORF 405
Synonyms CRABP-I; CRBP; CRBP1; CRBPI; RBPC
Locus ID 5947
UniProt ID P09455
Cytogenetics 3q23
Summary This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Write Your Own Review
You're reviewing:RBP1 (NM_002899) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401017 RBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401017 Transient overexpression lysate of retinol binding protein 1, cellular (RBP1), transcript variant 1 100 ug
$436.00
TP314515 Recombinant protein of human retinol binding protein 1, cellular (RBP1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.