MAGED2 (NM_201222) Human Recombinant Protein
CAT#: TP314066
Recombinant protein of human melanoma antigen family D, 2 (MAGED2), transcript variant 3, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214066 protein sequence
Red=Cloning site Green=Tags(s) MSDTSESGAGLTRFQAEASEKDSSSMMQTLLTVTQNVEVPETPKASKALEVSEDVKVSKASGVSKATEVS KTPEAREAPATQASSTTQLTDTQVLAAENKSLAADTKKQNADPQAVTMPATETKKVSHVADTKVNTKAQE TEAAPSQAPADEPEPESAAAQSQENQDTRPKVKAKKARKVKHLDGEEDGSSDQSQASGTTGGRRVSKALM ASMARRASRGPIAFWARRASRTRLAAWARRALLSLRSPKARRGKARRRAAKLQSSQEPEAPPPRDVALLQ GRANDLVKYLLAKDQTKIPIKRSDMLKDIIKEYTDVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLS TLEPTDAGILGTTKDSPKLGLLMVLLSIIFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFGDVKKLITDEF VKQKYLDYARVPNSNPPEYEFFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAMEADLKAAAEAA AEAKARAEIRARMGIGLGSENAAGPCNWDEADIGPWAKARIQAGAEAKAKAQESGSASTGASTSTNNSAS ASASTSGGFSAGASLTATLTFGLFAGLGGAGASTSGSSGACGFSYK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 64.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_957516 |
Locus ID | 10916 |
UniProt ID | Q9UNF1, A0A024R9Y7 |
Cytogenetics | Xp11.21 |
Refseq Size | 2176 |
Refseq ORF | 1818 |
Synonyms | 11B6; BARTS5; BCG-1; BCG1; HCA10; MAGE-D2 |
Summary | This gene is a member of the MAGED gene family. The MAGED genes are clustered on chromosome Xp11. This gene is located in Xp11.2, a hot spot for X-linked intellectual disability (XLID). Mutations in this gene cause a form of transient antenatal Bartter's syndrome. This gene may also be involved in several types of cancer, including breast cancer and melanoma. The protein encoded by this gene is progressively recruited from the cytoplasm to the nucleoplasm during the interphase and after nucleolar stress and is thus thought to play a role in cell cycle regulation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2017] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404585 | MAGED2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC406162 | MAGED2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC415179 | MAGED2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404585 | Transient overexpression lysate of melanoma antigen family D, 2 (MAGED2), transcript variant 3 |
USD 665.00 |
|
LY406162 | Transient overexpression lysate of melanoma antigen family D, 2 (MAGED2), transcript variant 2 |
USD 665.00 |
|
LY415179 | Transient overexpression lysate of melanoma antigen family D, 2 (MAGED2), transcript variant 1 |
USD 436.00 |
|
PH301748 | MAGED2 MS Standard C13 and N15-labeled recombinant protein (NP_055414) |
USD 3,255.00 |
|
PH314066 | MAGED2 MS Standard C13 and N15-labeled recombinant protein (NP_957516) |
USD 3,255.00 |
|
PH319260 | MAGED2 MS Standard C13 and N15-labeled recombinant protein (NP_803182) |
USD 3,255.00 |
|
TP301748 | Recombinant protein of human melanoma antigen family D, 2 (MAGED2), transcript variant 1, 20 µg |
USD 867.00 |
|
TP319260 | Recombinant protein of human melanoma antigen family D, 2 (MAGED2), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review