MAGED2 (NM_014599) Human Mass Spec Standard

SKU
PH301748
MAGED2 MS Standard C13 and N15-labeled recombinant protein (NP_055414)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201748]
Predicted MW 65 kDa
Protein Sequence
Protein Sequence
>RC201748 protein sequence
Red=Cloning site Green=Tags(s)

MSDTSESGAGLTRFQAEASEKDSSSMMQTLLTVTQNVEVPETPKASKALEVSEDVKVSKASGVSKATEVS
KTPEAREAPATQASSTTQLTDTQVLAAENKSLAADTKKQNADPQAVTMPATETKKVSHVADTKVNTKAQE
TEAAPSQAPADEPEPESAAAQSQENQDTRPKVKAKKARKVKHLDGEEDGSSDQSQASGTTGGRRVSKALM
ASMARRASRGPIAFWARRASRTRLAAWARRALLSLRSPKARRGKARRRAAKLQSSQEPEAPPPRDVALLQ
GRANDLVKYLLAKDQTKIPIKRSDMLKDIIKEYTDVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLS
TLEPTDAGILGTTKDSPKLGLLMVLLSIIFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFGDVKKLITDEF
VKQKYLDYARVPNSNPPEYEFFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAMEADLKAAAEAA
AEAKARAEIRARMGIGLGSENAAGPCNWDEADIGPWAKARIQAGAEAKAKAQESGSASTGASTSTNNSAS
ASASTSGGFSAGASLTATLTFGLFAGLGGAGASTSGSSGACGFSYK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055414
RefSeq Size 2108
RefSeq ORF 1818
Synonyms 11B6; BARTS5; BCG-1; BCG1; HCA10; MAGE-D2
Locus ID 10916
UniProt ID Q9UNF1
Cytogenetics Xp11.21
Summary This gene is a member of the MAGED gene family. The MAGED genes are clustered on chromosome Xp11. This gene is located in Xp11.2, a hot spot for X-linked intellectual disability (XLID). Mutations in this gene cause a form of transient antenatal Bartter's syndrome. This gene may also be involved in several types of cancer, including breast cancer and melanoma. The protein encoded by this gene is progressively recruited from the cytoplasm to the nucleoplasm during the interphase and after nucleolar stress and is thus thought to play a role in cell cycle regulation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2017]
Write Your Own Review
You're reviewing:MAGED2 (NM_014599) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH314066 MAGED2 MS Standard C13 and N15-labeled recombinant protein (NP_957516) 10 ug
$3,255.00
PH319260 MAGED2 MS Standard C13 and N15-labeled recombinant protein (NP_803182) 10 ug
$3,255.00
LC404585 MAGED2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406162 MAGED2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415179 MAGED2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404585 Transient overexpression lysate of melanoma antigen family D, 2 (MAGED2), transcript variant 3 100 ug
$665.00
LY406162 Transient overexpression lysate of melanoma antigen family D, 2 (MAGED2), transcript variant 2 100 ug
$665.00
LY415179 Transient overexpression lysate of melanoma antigen family D, 2 (MAGED2), transcript variant 1 100 ug
$436.00
TP301748 Recombinant protein of human melanoma antigen family D, 2 (MAGED2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP314066 Recombinant protein of human melanoma antigen family D, 2 (MAGED2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319260 Recombinant protein of human melanoma antigen family D, 2 (MAGED2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.