OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAGED2 (NM_177433) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP319260
Recombinant protein of human melanoma antigen family D, 2 (MAGED2), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA342768 Rabbit Polyclonal Anti-MAGED2 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MAGED2 or NM_177433"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219260 protein sequence
Red=Cloning site Green=Tags(s)

MSDTSESGAGLTRFQAEASEKDSSSMMQTLLTVTQNVEVPETPKASKALEVSEDVKVSKASGVSKATEVS
KTPEAREAPATQASSTTQLTDTQVLAAENKSLAADTKKQNADPQAVTMPATETKKVSHVADTKVNTKAQE
TEAAPSQAPADEPEPESAAAQSQENQDTRPKVKAKKARKVKHLDGEEDGSSDQSQASGTTGGRRVSKALM
ASMARRASRGPIAFWARRASRTRLAAWARRALLSLRSPKARRGKARRRAAKLQSSQEPEAPPPRDVALLQ
GRANDLVKYLLAKDQTKIPIKRSDMLKDIIKEYTDVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLS
TLEPTDAGILGTTKDSPKLGLLMVLLSIIFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFGDVKKLITDEF
VKQKYLDYARVPNSNPPEYEFFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAMEADLKAAAEAA
AEAKARAEIRARMGIGLGSENAAGPCNWDEADIGPWAKARIQAGAEAKAKAQESGSASTGASTSTNNSAS
ASASTSGGFSAGASLTATLTFGLFAGLGGAGASTSGSSGACGFSYK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 64.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_803182
Locus ID 10916
UniProt ID Q9UNF1
Cytogenetics Xp11.21
RefSeq Size 2216
RefSeq ORF 1818
Synonyms 11B6; BARTS5; BCG-1; BCG1; HCA10; MAGE-D2
Summary This gene is a member of the MAGED gene family. The MAGED genes are clustered on chromosome Xp11. This gene is located in Xp11.2, a hot spot for X-linked intellectual disability (XLID). Mutations in this gene cause a form of transient antenatal Bartter's syndrome. This gene may also be involved in several types of cancer, including breast cancer and melanoma. The protein encoded by this gene is progressively recruited from the cytoplasm to the nucleoplasm during the interphase and after nucleolar stress and is thus thought to play a role in cell cycle regulation. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2017
Protein Categories Endocrine and metabolic diseases, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MAGED2" proteins (11)
SKU Description Size Price
PH301748 MAGED2 MS Standard C13 and N15-labeled recombinant protein (NP_055414) 10 ug
$3,360.00
PH314066 MAGED2 MS Standard C13 and N15-labeled recombinant protein (NP_957516) 10 ug
$3,360.00
PH319260 MAGED2 MS Standard C13 and N15-labeled recombinant protein (NP_803182) 10 ug
$3,360.00
LC404585 Lyophilized MAGED2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406162 Lyophilized MAGED2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415179 Lyophilized MAGED2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404585 Transient overexpression lysate of melanoma antigen family D, 2 (MAGED2), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY406162 Transient overexpression lysate of melanoma antigen family D, 2 (MAGED2), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY415179 Transient overexpression lysate of melanoma antigen family D, 2 (MAGED2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301748 Recombinant protein of human melanoma antigen family D, 2 (MAGED2), transcript variant 1, 20 µg 20 ug
$867.00
TP314066 Recombinant protein of human melanoma antigen family D, 2 (MAGED2), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products