OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CPEB1 (NM_001079534) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP313337
Recombinant protein of human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA306607 Rabbit Polyclonal CPEB1 Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CPEB1 or NM_001079534"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213337 protein sequence
Red=Cloning site Green=Tags(s)

MLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSAQSSTHSVLSMLHNPLGNVLGKPPLS
FLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRSSSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLS
LSGGGPRDPLKMGVGSRMDQEQAALAAVTPSPTSASKRWPGASVWPSWDLLEAPKDPFSIEREARLHRQA
AAVNEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKG
YVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSR
TVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKF
TKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQKNRDSS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 53.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001073002
Locus ID 64506
UniProt ID Q9BZB8
Cytogenetics 15q25.2
RefSeq Size 3095
RefSeq ORF 1458
Synonyms CPE-BP1; CPEB; CPEB-1; h-CPEB; hCPEB-1
Summary This gene encodes a member of the cytoplasmic polyadenylation element binding protein family. This highly conserved protein binds to a specific RNA sequence, called the cytoplasmic polyadenylation element, found in the 3' untranslated region of some mRNAs. The encoded protein functions in both the cytoplasm and the nucleus. It is involved in the regulation of mRNA translation, as well as processing of the 3' untranslated region, and may play a role in cell proliferation and tumorigenesis. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jan 2014
Protein Categories Intracellular Proteins
Protein Pathways Dorso-ventral axis formation, Oocyte meiosis, Progesterone-mediated oocyte maturation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CPEB1" proteins (12)
SKU Description Size Price
PH306406 CPEB1 MS Standard C13 and N15-labeled recombinant protein (NP_001073003) 10 ug
$3,360.00
PH313337 CPEB1 MS Standard C13 and N15-labeled recombinant protein (NP_001073002) 10 ug
$3,360.00
LC410792 Lyophilized CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421521 Lyophilized CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421522 Lyophilized CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421523 Lyophilized CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410792 Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421521 Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY421522 Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 4 (as WB positive control) 100 ug
$665.00
LY421523 Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP306406 Recombinant protein of human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 3, 20 µg 20 ug
$867.00
TP761390 Purified recombinant protein of Human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products