CPEB1 (NM_001079535) Human Mass Spec Standard

SKU
PH306406
CPEB1 MS Standard C13 and N15-labeled recombinant protein (NP_001073003)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206406]
Predicted MW 53.6 kDa
Protein Sequence
Protein Sequence
>RC206406 protein sequence
Red=Cloning site Green=Tags(s)

MLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSAQSSTHSVLSMLHNPLGNVLGKPPLS
FLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRSSSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLS
LSGGGPRDPLKMGVGSRMDQEQAALAAVTPSPTSASKRWPGASVWPSWDLLEAPKDPFSIEREARLHRQA
AAVNEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKG
YVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSR
TVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKF
TKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQKNRDSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073003
RefSeq Size 3196
RefSeq ORF 1458
Synonyms CPE-BP1; CPEB; CPEB-1; h-CPEB; hCPEB-1
Locus ID 64506
UniProt ID Q9BZB8
Cytogenetics 15q25.2
Summary This gene encodes a member of the cytoplasmic polyadenylation element binding protein family. This highly conserved protein binds to a specific RNA sequence, called the cytoplasmic polyadenylation element, found in the 3' untranslated region of some mRNAs. The encoded protein functions in both the cytoplasm and the nucleus. It is involved in the regulation of mRNA translation, as well as processing of the 3' untranslated region, and may play a role in cell proliferation and tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Protein Pathways Dorso-ventral axis formation, Oocyte meiosis, Progesterone-mediated oocyte maturation
Write Your Own Review
You're reviewing:CPEB1 (NM_001079535) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH313337 CPEB1 MS Standard C13 and N15-labeled recombinant protein (NP_001073002) 10 ug
$3,255.00
LC410792 CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421521 CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421522 CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421523 CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410792 Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 1 100 ug
$436.00
LY421521 Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 2 100 ug
$665.00
LY421522 Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 4 100 ug
$665.00
LY421523 Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 3 100 ug
$436.00
TP306406 Recombinant protein of human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP313337 Recombinant protein of human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761390 Purified recombinant protein of Human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.