OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HMGA1 (NM_145902) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP313109
Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA322034 Anti-HMGA1 Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HMGA1 or NM_145902"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213109 representing NM_145902
Red=Cloning site Green=Tags(s)

MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGR
KPRGRPKKLEKEEEEGISQESSEEEQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 10.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_665909
Locus ID 3159
UniProt ID P17096
Cytogenetics 6p21.31
RefSeq Size 1843
RefSeq ORF 288
Synonyms HMG-R; HMGA1A; HMGIY
Summary This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. provided by RefSeq, Jan 2016
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HMGA1" proteins (25)
SKU Description Size Price
PH301458 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_002122) 10 ug
$3,360.00
PH302928 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665906) 10 ug
$3,360.00
PH304972 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665910) 10 ug
$3,360.00
PH313109 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665909) 10 ug
$3,360.00
PH317302 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665911) 10 ug
$3,360.00
PH317358 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665912) 10 ug
$3,360.00
LC407836 Lyophilized HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407837 Lyophilized HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407838 Lyophilized HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407839 Lyophilized HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407840 Lyophilized HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407841 Lyophilized HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419517 Lyophilized HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407836 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY407837 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY407838 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY407839 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY407840 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY407841 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 7 (as WB positive control) 100 ug
$436.00
LY419517 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301458 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 2, 20 µg 20 ug
$737.00
TP302928 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 1, 20 µg 20 ug
$737.00
TP304972 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 5, 20 µg 20 ug
$737.00
TP317302 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 6, 20 µg 20 ug
$737.00
TP317358 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 7, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products