HMGA1 (NM_145905) Human Mass Spec Standard

SKU
PH317358
HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665912)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217358]
Predicted MW 10.7 kDa
Protein Sequence
Protein Sequence
>RC217358 protein sequence
Red=Cloning site Green=Tags(s)

MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGR
KPRGRPKKLEKEEEEGISQESSEEEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_665912
RefSeq Size 1887
RefSeq ORF 288
Synonyms HMG-R; HMGA1A; HMGIY
Locus ID 3159
UniProt ID P17096
Cytogenetics 6p21.31
Summary This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. [provided by RefSeq, Jan 2016]
Protein Families Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors
Write Your Own Review
You're reviewing:HMGA1 (NM_145905) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301458 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_002122) 10 ug
$3,255.00
PH302928 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665906) 10 ug
$3,255.00
PH304972 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665910) 10 ug
$3,255.00
PH313109 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665909) 10 ug
$3,255.00
PH317302 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665911) 10 ug
$3,255.00
LC407836 HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407837 HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407838 HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407839 HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407840 HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407841 HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419517 HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407836 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 1 100 ug
$436.00
LY407837 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 3 100 ug
$436.00
LY407838 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 4 100 ug
$436.00
LY407839 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 5 100 ug
$436.00
LY407840 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 6 100 ug
$436.00
LY407841 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 7 100 ug
$436.00
LY419517 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 2 100 ug
$436.00
TP301458 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 2, 20 µg 20 ug
$737.00
TP302928 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 1, 20 µg 20 ug
$737.00
TP304972 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 5, 20 µg 20 ug
$737.00
TP313109 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 4, 20 µg 20 ug
$737.00
TP317302 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 6, 20 µg 20 ug
$737.00
TP317358 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 7, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.