OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HMGA1 (NM_145899) Human Mass Spec Standard

Be the first to review this product
SKU
PH302928
HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665906)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322034 Anti-HMGA1 Rabbit Polyclonal Antibody
100 ul
$305.00
LY407836 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "HMGA1 or NM_145899"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202928
Predicted MW 11.7 kDa
Protein Sequence
Protein Sequence
>RC202928 protein sequence
Red=Cloning site Green=Tags(s)

MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAA
KTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_665906
RefSeq Size 2031
RefSeq ORF 321
Synonyms HMG-R; HMGA1A; HMGIY
Locus ID 3159
UniProt ID P17096
Cytogenetics 6p21.31
Summary This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. provided by RefSeq, Jan 2016
Protein Families Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HMGA1" proteins (25)
SKU Description Size Price
PH301458 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_002122) 10 ug
$3,360.00
PH304972 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665910) 10 ug
$3,360.00
PH313109 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665909) 10 ug
$3,360.00
PH317302 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665911) 10 ug
$3,360.00
PH317358 HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665912) 10 ug
$3,360.00
LC407836 Lyophilized HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407837 Lyophilized HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407838 Lyophilized HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407839 Lyophilized HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407840 Lyophilized HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407841 Lyophilized HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419517 Lyophilized HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407836 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY407837 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY407838 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY407839 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY407840 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY407841 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 7 (as WB positive control) 100 ug
$436.00
LY419517 Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301458 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 2, 20 µg 20 ug
$737.00
TP302928 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 1, 20 µg 20 ug
$737.00
TP304972 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 5, 20 µg 20 ug
$737.00
TP313109 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 4, 20 µg 20 ug
$737.00
TP317302 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 6, 20 µg 20 ug
$737.00
TP317358 Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 7, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products