HMGA1 (NM_145904) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC217302] |
Predicted MW | 11.7 kDa |
Protein Sequence |
Protein Sequence
>RC217302 protein sequence
Red=Cloning site Green=Tags(s) MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAA KTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_665911 |
RefSeq Size | 1978 |
RefSeq ORF | 321 |
Synonyms | AL023995; high mobility group AT-hook 1; high mobility group protein I; HMG-I(Y); HMG-R, HMGIY, HMGA1A, MGC4242, MGC4854, MGC12816; Hmga1a; Hmga1b; Hmgi; HMGI(Y); Hmgiy; HMGY; MGC102580 |
Locus ID | 3159 |
UniProt ID | P17096 |
Cytogenetics | 6p21.31 |
Summary | This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301458 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_002122) | 10 ug |
$3,255.00
|
|
PH302928 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665906) | 10 ug |
$3,255.00
|
|
PH304972 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665910) | 10 ug |
$3,255.00
|
|
PH313109 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665909) | 10 ug |
$3,255.00
|
|
PH317358 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665912) | 10 ug |
$3,255.00
|
|
LC407836 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC407837 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC407838 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC407839 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC407840 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC407841 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419517 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY407836 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 1 | 100 ug |
$436.00
|
|
LY407837 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 3 | 100 ug |
$436.00
|
|
LY407838 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 4 | 100 ug |
$436.00
|
|
LY407839 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 5 | 100 ug |
$436.00
|
|
LY407840 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 6 | 100 ug |
$436.00
|
|
LY407841 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 7 | 100 ug |
$436.00
|
|
LY419517 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 2 | 100 ug |
$436.00
|
|
TP301458 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP302928 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP304972 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 5, 20 µg | 20 ug |
$737.00
|
|
TP313109 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
TP317302 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 6, 20 µg | 20 ug |
$737.00
|
|
TP317358 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 7, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.