OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LRPAP1 (NM_002337) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP311255
Recombinant protein of human low density lipoprotein receptor-related protein associated protein 1 (LRPAP1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA323026 Anti-LRPAP1 Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "LRPAP1 or NM_002337"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211255 protein sequence
Red=Cloning site Green=Tags(s)

MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLH
LPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSG
TQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLS
DIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREE
LKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRIS
RARHNEL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 37.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002328
Locus ID 4043
UniProt ID P30533
Cytogenetics 4p16.3
RefSeq Size 10536
RefSeq ORF 1071
Synonyms A2MRAP; A2RAP; alpha-2-MRAP; HBP44; MRAP; MYP23; RAP
Summary This gene encodes a protein that interacts with the low density lipoprotein (LDL) receptor-related protein and facilitates its proper folding and localization by preventing the binding of ligands. Mutations in this gene have been identified in individuals with myopia 23. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2013
Protein Categories Intracellular Proteins, Nervous system Diseases
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LRPAP1" proteins (3)
SKU Description Size Price
PH311255 LRPAP1 MS Standard C13 and N15-labeled recombinant protein (NP_002328) 10 ug
$3,360.00
LC419397 Lyophilized LRPAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419397 Transient overexpression lysate of low density lipoprotein receptor-related protein associated protein 1 (LRPAP1) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products