LRPAP1 (NM_002337) Human Recombinant Protein

CAT#: TP311255

Recombinant protein of human low density lipoprotein receptor-related protein associated protein 1 (LRPAP1), 20 µg

Product Images

Coomassie blue staining of purified LRPAP1 protein (Cat# TP311255). The protein was produced from HEK293T cells transfected with LRPAP1 cDNA clone (Cat# RC211255) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211255 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLH
  LPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSG
  TQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLS
  DIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREE
  LKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRIS
  RARHNEL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 37.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002328
• Locus ID: 4043
• UniProt ID: P30533
• Cytogenetics: 4p16.3
• Refseq Size: 10536
• Refseq ORF: 1071
• Synonyms: A2MRAP; A2RAP; alpha-2-MRAP; HBP44; MRAP; MYP23; RAP
• Summary: This gene encodes a protein that interacts with the low density lipoprotein (LDL) receptor-related protein and facilitates its proper folding and localization by preventing the binding of ligands. Mutations in this gene have been identified in individuals with myopia 23. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]
• Protein Families: Druggable Genome, Transmembrane