OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LRPAP1 (NM_002337) Human Mass Spec Standard

Be the first to review this product
SKU
PH311255
LRPAP1 MS Standard C13 and N15-labeled recombinant protein (NP_002328)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA323026 Anti-LRPAP1 Rabbit Polyclonal Antibody
100 ul
$305.00
LY419397 Transient overexpression lysate of low density lipoprotein receptor-related protein associated protein 1 (LRPAP1) (as WB positive control) 100 ug
$436.00

Other products for "LRPAP1 or NM_002337"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211255
Predicted MW 41.5 kDa
Protein Sequence
Protein Sequence
>RC211255 protein sequence
Red=Cloning site Green=Tags(s)

MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLH
LPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSG
TQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLS
DIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREE
LKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRIS
RARHNEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002328
RefSeq Size 10536
RefSeq ORF 1071
Synonyms A2MRAP; A2RAP; alpha-2-MRAP; HBP44; MRAP; MYP23; RAP
Locus ID 4043
UniProt ID P30533
Cytogenetics 4p16.3
Summary This gene encodes a protein that interacts with the low density lipoprotein (LDL) receptor-related protein and facilitates its proper folding and localization by preventing the binding of ligands. Mutations in this gene have been identified in individuals with myopia 23. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2013
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LRPAP1" proteins (3)
SKU Description Size Price
LC419397 Lyophilized LRPAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419397 Transient overexpression lysate of low density lipoprotein receptor-related protein associated protein 1 (LRPAP1) (as WB positive control) 100 ug
$436.00
TP311255 Recombinant protein of human low density lipoprotein receptor-related protein associated protein 1 (LRPAP1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products