OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GMPR2 (NM_001002001) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310599
Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA346626 Rabbit Polyclonal Anti-GMPR2 Antibody
100 ul
$525.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "GMPR2 or NM_001002001"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210599 protein sequence
Red=Cloning site Green=Tags(s)

MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKF
SLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVE
FVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAH
GLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAG
GVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 37.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001002001
Locus ID 51292
UniProt ID Q9P2T1
Cytogenetics 14q12
RefSeq Size 1930
RefSeq ORF 1044
Synonyms GMPR 2
Summary This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. provided by RefSeq, Apr 2017
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Purine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GMPR2" proteins (15)
SKU Description Size Price
PH303418 GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002000) 10 ug
$3,360.00
PH303584 GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_057660) 10 ug
$3,360.00
PH310599 GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002001) 10 ug
$3,360.00
PH323106 GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002002) 10 ug
$3,360.00
LC413898 Lyophilized GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424314 Lyophilized GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424315 Lyophilized GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424316 Lyophilized GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413898 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY424314 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424315 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY424316 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP303418 Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, 20 µg 20 ug
$867.00
TP303584 Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, 20 µg 20 ug
$867.00
TP323106 Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products