GMPR2 (NM_016576) Human Recombinant Protein
SKU
TP303584
Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC203584 protein sequence
Red=Cloning site Green=Tags(s) MTSCLPALRFIATPRLSAMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIA ANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQ VKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKT GVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKK YKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTT FIRVTQQVNPIFSEAC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_057660 |
Locus ID | 51292 |
UniProt ID | Q9P2T1 |
Cytogenetics | 14q12 |
RefSeq Size | 1910 |
RefSeq ORF | 1098 |
Synonyms | GMPR 2 |
Summary | This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Purine metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303418 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002000) | 10 ug |
$3,255.00
|
|
PH303584 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_057660) | 10 ug |
$3,255.00
|
|
PH310599 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002001) | 10 ug |
$3,255.00
|
|
PH323106 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002002) | 10 ug |
$3,255.00
|
|
LC413898 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC424314 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC424315 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC424316 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY413898 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 1 | 100 ug |
$436.00
|
|
LY424314 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 2 | 100 ug |
$436.00
|
|
LY424315 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 3 | 100 ug |
$436.00
|
|
LY424316 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 4 | 100 ug |
$436.00
|
|
TP303418 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP310599 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP323106 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.