GMPR2 (NM_016576) Human Recombinant Protein

SKU
TP303584
Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203584 protein sequence
Red=Cloning site Green=Tags(s)

MTSCLPALRFIATPRLSAMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIA
ANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQ
VKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKT
GVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKK
YKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTT
FIRVTQQVNPIFSEAC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057660
Locus ID 51292
UniProt ID Q9P2T1
Cytogenetics 14q12
RefSeq Size 1910
RefSeq ORF 1098
Synonyms GMPR 2
Summary This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017]
Protein Families Druggable Genome
Protein Pathways Purine metabolism
Write Your Own Review
You're reviewing:GMPR2 (NM_016576) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303418 GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002000) 10 ug
$3,255.00
PH303584 GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_057660) 10 ug
$3,255.00
PH310599 GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002001) 10 ug
$3,255.00
PH323106 GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002002) 10 ug
$3,255.00
LC413898 GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424314 GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424315 GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424316 GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413898 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 1 100 ug
$436.00
LY424314 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 2 100 ug
$436.00
LY424315 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 3 100 ug
$436.00
LY424316 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 4 100 ug
$436.00
TP303418 Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP310599 Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323106 Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.