GMPR2 (NM_016576) Human Mass Spec Standard

SKU
PH303584
GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_057660)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203584]
Predicted MW 39.8 kDa
Protein Sequence
Protein Sequence
>RC203584 protein sequence
Red=Cloning site Green=Tags(s)

MTSCLPALRFIATPRLSAMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIA
ANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQ
VKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKT
GVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKK
YKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTT
FIRVTQQVNPIFSEAC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057660
RefSeq Size 1910
RefSeq ORF 1098
Synonyms GMPR 2
Locus ID 51292
UniProt ID Q9P2T1
Cytogenetics 14q12
Summary This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017]
Protein Families Druggable Genome
Protein Pathways Purine metabolism
Write Your Own Review
You're reviewing:GMPR2 (NM_016576) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303418 GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002000) 10 ug
$3,255.00
PH310599 GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002001) 10 ug
$3,255.00
PH323106 GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002002) 10 ug
$3,255.00
LC413898 GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424314 GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424315 GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424316 GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413898 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 1 100 ug
$436.00
LY424314 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 2 100 ug
$436.00
LY424315 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 3 100 ug
$436.00
LY424316 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 4 100 ug
$436.00
TP303418 Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP303584 Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP310599 Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323106 Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.