OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GMPR2 (NM_016576) Human Mass Spec Standard

Be the first to review this product
SKU
PH303584
GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_057660)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA346626 Rabbit Polyclonal Anti-GMPR2 Antibody
100 ul
$525.00
LY413898 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "GMPR2 or NM_016576"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203584
Predicted MW 39.8 kDa
Protein Sequence
Protein Sequence
>RC203584 protein sequence
Red=Cloning site Green=Tags(s)

MTSCLPALRFIATPRLSAMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIA
ANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQ
VKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKT
GVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKK
YKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTT
FIRVTQQVNPIFSEAC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057660
RefSeq Size 1910
RefSeq ORF 1098
Synonyms GMPR 2
Locus ID 51292
UniProt ID Q9P2T1
Cytogenetics 14q12
Summary This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. provided by RefSeq, Apr 2017
Protein Families Druggable Genome
Protein Pathways Purine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GMPR2" proteins (15)
SKU Description Size Price
PH303418 GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002000) 10 ug
$3,360.00
PH310599 GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002001) 10 ug
$3,360.00
PH323106 GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002002) 10 ug
$3,360.00
LC413898 Lyophilized GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424314 Lyophilized GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424315 Lyophilized GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424316 Lyophilized GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413898 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY424314 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424315 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY424316 Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP303418 Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, 20 µg 20 ug
$867.00
TP303584 Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, 20 µg 20 ug
$867.00
TP310599 Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, 20 µg 20 ug
$867.00
TP323106 Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products