OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

JMJD6 (NM_015167) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308993
Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA306835 Rabbit Polyclonal JMJD6 Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "JMJD6 or NM_015167"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208993 protein sequence
Red=Cloning site Green=Tags(s)

MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPV
VLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEH
PKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFP
TSTPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDT
TIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSS
SSSSSDSDSECESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 46.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Co-immunoprecipitation (PMID: 28790175)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055982
Locus ID 23210
UniProt ID Q6NYC1
Cytogenetics 17q25.1
RefSeq Size 1834
RefSeq ORF 1209
Synonyms PSR; PTDSR; PTDSR1
Summary This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "JMJD6" proteins (7)
SKU Description Size Price
PH308993 JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_055982) 10 ug
$3,360.00
PH318163 JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_001074930) 10 ug
$3,360.00
LC414758 Lyophilized JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421156 Lyophilized JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414758 Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY421156 Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP318163 Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

Antibody-mediated blockade of JMJD6 interaction with collagen I exerts antifibrotic and antimetastatic activities
Miotti, Gulino, Ferri et al
FASEB J (2017) 31 (12), 5356-5370 DOI: 10.1096/fj.201700377R
AI Summary: In this study, OriGene's recombinant human JMJD6 protein (Cat# TP300845) was used to investigate JMJD6's binding to collagen I and its role in modulating collagen fibrillogenesis and tumor cell adhesion.
Redistribution of demethylated RNA helicase A during foot-and-mouth disease virus infection: Role of Jumonji C-domain containing protein 6 in RHA demethylation
Lawrence, Conderino, Rieder
Virology (2014) 452-453, 1-11
AI Summary: OriGene provided purified recombinant JMJD6 transcript variant 1, which was used in the study to investigate the role of JMJD6 in RNA helicase A demethylation during foot-and-mouth disease virus infection.
Snippet: Ann Arbor, MI). Purified recombinant JMJD6 transcript variant 1 was purchased from two different manufacturers: Origene (Rockville, MD) and Cayman Chemical Company (Ann Arbor, MI). Antibodies. Polyclonal rabbit anti-JMJD6 ... Cite SaveSaving
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products