JMJD6 (NM_015167) Human Mass Spec Standard

SKU
PH308993
JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_055982)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208993]
Predicted MW 46.5 kDa
Protein Sequence
Protein Sequence
>RC208993 protein sequence
Red=Cloning site Green=Tags(s)

MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPV
VLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEH
PKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFP
TSTPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDT
TIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSS
SSSSSDSDSECESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055982
RefSeq Size 1834
RefSeq ORF 1209
Synonyms PSR; PTDSR; PTDSR1
Locus ID 23210
UniProt ID Q6NYC1
Cytogenetics 17q25.1
Summary This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Write Your Own Review
You're reviewing:JMJD6 (NM_015167) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH318163 JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_001074930) 10 ug
$3,255.00
LC414758 JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421156 JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414758 Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 2 100 ug
$436.00
LY421156 Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 1 100 ug
$436.00
TP308993 Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 2, 20 µg 20 ug
$737.00
TP318163 Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.