OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

JMJD6 (NM_015167) Human Mass Spec Standard

Be the first to review this product
SKU
PH308993
JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_055982)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306835 Rabbit Polyclonal JMJD6 Antibody
100 ug
$640.00
LY414758 Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "JMJD6 or NM_015167"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208993
Predicted MW 46.5 kDa
Protein Sequence
Protein Sequence
>RC208993 protein sequence
Red=Cloning site Green=Tags(s)

MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPV
VLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEH
PKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFP
TSTPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDT
TIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSS
SSSSSDSDSECESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055982
RefSeq Size 1834
RefSeq ORF 1209
Synonyms PSR; PTDSR; PTDSR1
Locus ID 23210
UniProt ID Q6NYC1
Cytogenetics 17q25.1
Summary This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "JMJD6" proteins (7)
SKU Description Size Price
PH318163 JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_001074930) 10 ug
$3,360.00
LC414758 Lyophilized JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421156 Lyophilized JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414758 Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY421156 Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308993 Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 2, 20 µg 20 ug
$737.00
TP318163 Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products