JMJD6 (NM_001081461) Human Recombinant Protein

SKU
TP318163
Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218163 representing NM_001081461
Red=Cloning site Green=Tags(s)

MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPV
VLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEH
PKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFP
TSTPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDT
TIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSS
SSSSSDSDSECESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSRIRDTCGGRAHP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 47.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001074930
Locus ID 23210
UniProt ID Q6NYC1
Cytogenetics 17q25.1
RefSeq Size 5445
RefSeq ORF 1242
Synonyms PSR; PTDSR; PTDSR1
Summary This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Write Your Own Review
You're reviewing:JMJD6 (NM_001081461) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308993 JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_055982) 10 ug
$3,255.00
PH318163 JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_001074930) 10 ug
$3,255.00
LC414758 JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421156 JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414758 Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 2 100 ug
$436.00
LY421156 Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 1 100 ug
$436.00
TP308993 Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.