RRM2 (NM_001034) Human Recombinant Protein

CAT#: TP305718

Reviews ()
Write a review

Recombinant protein of human ribonucleotide reductase M2 polypeptide (RRM2)

Size: 20 ug 100 ug 1 mg



  View other "RRM2" proteins (5)

USD 867.00

In Stock*

Size
    • 20 ug

Product images

Frequently bought together (2)
Recombinant Anti-RRM2 (Clone SAIC-30C-18)
    • 200 ug

USD 556.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Other products for "RRM2"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC205718 representing NM_001034
Red=Cloning site Green=Tags(s)

MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDE
PLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGI
VNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWA
LRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL
VHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM
ENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 44.7 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Bioactivity Binding assay (PMID: 29765556)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001025
Locus ID 6241
UniProt ID P31350
Cytogenetics 2p25.1
Refseq Size 2500
Refseq ORF 1167
Synonyms C2orf48; R2; RR2; RR2M
Summary This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq, Sep 2009]
Protein Families Druggable Genome
Protein Pathways Glutathione metabolism, Metabolic pathways, p53 signaling pathway, Purine metabolism, Pyrimidine metabolism

Documents

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.