RRM2 (NM_001034) Human Mass Spec Standard

SKU
PH305718
RRM2 MS Standard C13 and N15-labeled recombinant protein (NP_001025)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205718]
Predicted MW 44.7 kDa
Protein Sequence
Protein Sequence
>RC205718 representing NM_001034
Red=Cloning site Green=Tags(s)

MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDE
PLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGI
VNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWA
LRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL
VHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM
ENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001025
RefSeq Size 2500
RefSeq ORF 1167
Synonyms C2orf48; R2; RR2; RR2M
Locus ID 6241
UniProt ID P31350
Cytogenetics 2p25.1
Summary This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq, Sep 2009]
Protein Families Druggable Genome
Protein Pathways Glutathione metabolism, Metabolic pathways, p53 signaling pathway, Purine metabolism, Pyrimidine metabolism
Write Your Own Review
You're reviewing:RRM2 (NM_001034) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421950 RRM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431390 RRM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421950 Transient overexpression lysate of ribonucleotide reductase M2 (RRM2), transcript variant 2 100 ug
$436.00
LY431390 Transient overexpression lysate of ribonucleotide reductase M2 (RRM2), transcript variant 1 100 ug
$436.00
TP305718 Recombinant protein of human ribonucleotide reductase M2 polypeptide (RRM2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.